PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA11725
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family G2-like
Protein Properties Length: 334aa    MW: 37566.9 Da    PI: 6.8496
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA11725genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like94.96.2e-30194248156
                    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                                k+r+ W++eLH+rFv+a++qLGG++ AtPk+i+e m+v+gLt+++vkSHLQkYRl+
  Tp57577_TGAC_v2_mRNA11725 194 KQRRSWSSELHRRFVDALQQLGGAH-ATPKQIREKMQVDGLTNDEVKSHLQKYRLH 248
                                79*******************9988.****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.558191250IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.2E-28191251IPR009057Homeodomain-like
SuperFamilySSF466891.52E-17192251IPR009057Homeodomain-like
TIGRFAMsTIGR015572.2E-26194248IPR006447Myb domain, plants
PfamPF002491.2E-7196246IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010092Biological Processspecification of organ identity
GO:0010629Biological Processnegative regulation of gene expression
GO:0048449Biological Processfloral organ formation
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MEQQKQQLNL DLTLALASVP KTVSHFLNDV VSQTNNSSEK LSNLDDLLHR LEEEMNKVLA  60
FKRELPLCII LLNNAIETLK EEKEKVRLMK MEDPKNSSDN KKNWMNSVHL WTNENNSNED  120
VERCVSKKSN GGGVFMEFNG NSLKEVSQVP SYSLVSEVSH GNSKSGGSSG SSLVRVETQN  180
QPQPPHPLQQ NSRKQRRSWS SELHRRFVDA LQQLGGAHAT PKQIREKMQV DGLTNDEVKS  240
HLQKYRLHVR RFPVSSIEEA NKLALYMTQD HREDTSKGNI SESLSPQGPL TPLLLGGSVK  300
GLSSHGRNSM DADDEQSDCR NWKGDHEQLH EAE*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00629PBMTransfer from PK14402.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013453507.11e-157myb-like DNA-binding domain, shaqkyf class protein
TrEMBLA0A072UEL31e-157A0A072UEL3_MEDTR; Myb-like DNA-binding domain, shaqkyf class protein
STRINGGLYMA01G39040.11e-107(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.18e-56G2-like family protein